| Product Name | Adrenomedullin (AM) (22-52), human |
| Synonyms | Adrenomedullin Fragment 22-52, human; 22-52-Adrenomedullin (human); Human adrenomedullin(22-52); ADM(22-52) |
| CAS Number | 159899-65-7 |
| Sequence (3-Letter) | H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 |
| Sequence (1-Letter) | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (31 residues; no disulfide ring) |
| Molecular Formula | C₁₅₉H₂₅₂N₄₆O₄₈ |
| Molecular Weight | 3576.1 |
| Category | Drug Peptide – Adrenomedullin Receptor Antagonist |
| Purity | ≥95% (by HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate or TFA (salt form per specification) |
| Peptide Content | ≥80% (per specification) |
| Solubility | Soluble in water |
| Storage | -20°C, desiccated, protected from light |
| Available Scale | mg – g (research quantities; larger scale on enquiry) |
| QC Documentation | COA, HPLC, MS identity (additional API/regulatory documentation on request) |
| Usage | For research and pharmaceutical development use, and as a reference standard or active pharmaceutical ingredient for manufacturing. Not for human or veterinary use; not for sale to patients. Any therapeutic use is subject to applicable regulatory approval. |
Adrenomedullin (22-52), human is a fragment of adrenomedullin made of residues twenty-two to fifty-two, a thirty-one-residue peptide (CAS 159899-65-7). Its sequence is TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY with a C-terminal amide. Because it leaves out the start of the full hormone, it has no disulfide ring and does not lower blood pressure; instead it blocks the adrenomedullin receptor. We supply it as a white powder for research and pharmaceutical development.
Adrenomedullin (22-52) works as an antagonist. It binds the adrenomedullin receptor, formed by the calcitonin-receptor-like receptor with receptor-activity-modifying proteins, without switching it on, so it competes with full adrenomedullin and blocks the rise in cyclic AMP that the full peptide would cause. It also antagonises the closely related CGRP receptor.
Adrenomedullin (22-52) is used in research as an adrenomedullin-receptor and CGRP-receptor antagonist, to probe the roles of adrenomedullin signalling in the cardiovascular system and other tissues. This is background information only; the material we supply is for research and pharmaceutical manufacturing use, and is not for human or veterinary use and not for sale to patients.
We supply Adrenomedullin (22-52) with a certificate of analysis, HPLC purity data, and mass-spec identity confirmation. Additional documentation for API and regulatory work is available on request, and salt form and purity can be set to your specification.
Yes. We manufacture Adrenomedullin (22-52) in-house and supply from research quantities up to scale-up batches. As a thirty-one-residue peptide it is a demanding synthesis, and we can discuss the right approach for your scale. Contact us with your required purity and quantity for a quote.
Adrenomedullin (22-52), human is a C-terminal fragment of the hormone adrenomedullin that acts as an adrenomedullin-receptor antagonist. It is widely used as a research peptide, and we supply it as a raw material for research and pharmaceutical development.
Adrenomedullin (22-52) is a thirty-one-residue peptide, TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY, with a C-terminal amide. It corresponds to residues twenty-two to fifty-two of full adrenomedullin, leaving out the N-terminal segment that carries the disulfide ring. Because it lacks that ring it does not reproduce the blood-pressure-lowering, vasodilator activity of the full peptide. Its CAS number is 159899-65-7, its molecular formula is C159H252N46O48, and its molecular weight is about 3576.
Adrenomedullin (22-52) behaves as a competitive antagonist. It binds the receptor formed by the calcitonin-receptor-like receptor together with receptor-activity-modifying proteins (RAMP2 and RAMP3) without activating it, thereby blocking the cyclic-AMP response that full adrenomedullin would trigger. It also antagonises the closely related CGRP receptor, which makes it a useful tool for separating adrenomedullin and CGRP signalling.
This fragment is the antagonist counterpart of the full agonist peptide adrenomedullin (1-52). The full peptide keeps the N-terminal disulfide ring and acts as a potent vasodilator at the receptor, while adrenomedullin (22-52) removes that ring and instead blocks the receptor, so the two are often used together in research to switch adrenomedullin signalling on and off.
We supply Adrenomedullin (22-52) with a certificate of analysis, HPLC purity data, and mass-spectrometry identity confirmation, with further documentation available to support active pharmaceutical ingredient and regulatory work. Purity and counter-ion can be set to your specification for use as a reference standard or in research.
We manufacture Adrenomedullin (22-52) by solid-phase synthesis, including the C-terminal amide, and supply it from research quantities through to scale-up batches. As a long thirty-one-residue peptide it benefits from established large-scale and modification capabilities. For related services, see drug peptides, custom peptide synthesis, and peptide modification. Material is supplied for research and pharmaceutical manufacturing use only.
