| Product Name | Exenatide Acetate |
| Synonyms | Exenatide, Exendin-4, Byetta, Bydureon, AC2993, AI3-15415 |
| CAS Number | 141732-76-5 (acetate); exendin-4 free base 141758-74-9 |
| Sequence (3-Letter) | H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ |
| Sequence (1-Letter) | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂ |
| Molecular Formula | C₁₈₄H₂₈₂N₅₀O₆₀S |
| Molecular Weight | 4186.57 |
| Category | Drug Peptide – GLP-1 Receptor Agonist |
| Purity | ≥98% (by HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate (TFA-free available; salt form per specification) |
| Peptide Content | ≥80% (per specification) |
| Solubility | Soluble in water |
| Storage | -20°C, desiccated, protected from light |
| Available Scale | mg – kg (research quantities to scale-up batches) |
| QC Documentation | COA, HPLC, MS identity (additional API/regulatory documentation on request) |
| Usage | For research and pharmaceutical development use, and as a reference standard or active pharmaceutical ingredient for manufacturing. Not for human or veterinary use; not for sale to patients. Any therapeutic use is subject to applicable regulatory approval. |
Exenatide Acetate is the acetate salt of exenatide, a synthetic 39-amino-acid peptide and GLP-1 receptor agonist, also known as exendin-4 (CAS 141732-76-5; exendin-4 free base 141758-74-9). Its sequence is HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, with a C-terminal amide, and it was originally found in the saliva of the Gila monster. We supply it as a white powder for research and pharmaceutical development.
Exenatide is an incretin mimetic: it activates the GLP-1 receptor, the same receptor used by the natural gut hormone GLP-1. Through it, exenatide increases insulin release in a glucose-dependent way, lowers glucagon, and slows stomach emptying. Because it resists the enzyme that quickly breaks down natural GLP-1, it acts far longer than the natural hormone.
Clinically, exenatide is used to improve blood-sugar control in type 2 diabetes, often added on to other diabetes medicines. This is background information only; the material we supply is for research and pharmaceutical manufacturing use, and is not for human or veterinary use and not for sale to patients.
We supply Exenatide Acetate with a certificate of analysis, HPLC purity data, and mass-spec identity confirmation. Additional documentation for API and regulatory work is available on request, and salt form and purity can be set to your specification.
Yes. We manufacture Exenatide Acetate in-house and supply from research quantities up to scale-up batches. Contact us with your required purity, salt form, and quantity for a quote.
Exenatide Acetate is the acetate salt of exenatide, a synthetic 39-amino-acid peptide and GLP-1 receptor agonist, also known as exendin-4. It is known as a medicine under brand names such as Byetta and Bydureon. We supply it as a raw material for research and pharmaceutical development.
Exenatide is a 39-residue peptide with the sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS and a C-terminal amide. It is the synthetic form of exendin-4, a peptide originally isolated from the saliva of the Gila monster, and it shares about half of its sequence with the human gut hormone GLP-1. Its acetate-salt CAS number is 141732-76-5 (exendin-4 free base 141758-74-9), its molecular formula is C184H282N50O60S, and its molecular weight is about 4187.
Exenatide is an incretin mimetic. It activates the GLP-1 receptor, the same receptor used by the natural hormone GLP-1, and through it increases insulin release in a glucose-dependent way, lowers the hormone glucagon, and slows gastric emptying. Unlike natural GLP-1, which is broken down within minutes by the enzyme DPP-4, exenatide resists that enzyme and so acts for much longer, which is what made it useful as a long-acting analog.
Exenatide is used clinically to improve blood-sugar control in type 2 diabetes, often as an add-on to other glucose-lowering medicines. This information is provided as scientific and reference background only. The material supplied by SynPeptide is intended for research and pharmaceutical manufacturing, is not for human or veterinary use, and is not for sale to patients; any therapeutic use is subject to applicable regulatory approval.
We supply Exenatide Acetate with a certificate of analysis, HPLC purity data, and mass-spectrometry identity confirmation, with further documentation available to support active pharmaceutical ingredient and regulatory work. As a 39-residue peptide it calls for careful synthesis and purification; purity, salt form, and counter-ion can be set to your specification for use as a reference standard or in process development.
We manufacture Exenatide Acetate by solid-phase synthesis and supply it from research quantities through to scale-up batches. For related capabilities, see drug peptides, custom peptide synthesis, large-scale peptide synthesis, and our peptide CDMO services. Material is supplied for research and pharmaceutical manufacturing use only.
