| Product Name | ACTH (1-39), rat |
| Synonyms | Adrenocorticotropic Hormone (1-39), rat; ACTH (1-39) (mouse, rat); α1-39-Corticotropin (rat); Corticotropin A |
| CAS Number | 77465-10-2 |
| Sequence (3-Letter) | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH |
| Sequence (1-Letter) | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF (39 residues; mouse/rat sequence) |
| Molecular Formula | C₂₁₀H₃₁₅N₅₇O₅₇S |
| Molecular Weight | 4582.2 |
| Category | Drug Peptide – Full-Length ACTH (MC2 Receptor Agonist) |
| Purity | ≥98% (by HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate or TFA (salt form per specification) |
| Peptide Content | ≥80% (per specification) |
| Solubility | Soluble in water |
| Storage | -20°C, desiccated, protected from light |
| Available Scale | mg – g (research quantities; larger scale on enquiry) |
| QC Documentation | COA, HPLC, MS identity (additional documentation on request) |
| Usage | For research and pharmaceutical development use, and as a reference standard. Not for human or veterinary use; not for sale to patients. Any therapeutic use is subject to applicable regulatory approval. |
ACTH (1-39), rat is the full-length form of the hormone ACTH (adrenocorticotropic hormone) with the rat amino-acid sequence, a thirty-nine-residue peptide (CAS 77465-10-2). Its sequence is SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF, matching mouse and rat ACTH, which differs from the human form in the part after residue twenty-four. We supply it as a white powder for research and pharmaceutical development.
ACTH (1-39), rat is a potent agonist of the melanocortin type-two receptor on the adrenal cortex. Binding this receptor signals the adrenal glands to make and release corticosteroids, and ACTH also has melanocortin activity at related receptors. As the full-length hormone, it carries both the active core and the longer sequence that supports strong, sustained activity.
ACTH (1-39), rat is used as a research peptide, mainly in rodent studies of the adrenal stress axis, melanocortin receptor signalling, and related neuroscience and metabolism work, where the rat-specific sequence is preferred. This is background information only; the material we supply is for research and pharmaceutical manufacturing use, and is not for human or veterinary use and not for sale to patients.
We supply ACTH (1-39), rat with a certificate of analysis, HPLC purity data, and mass-spec identity confirmation. Additional documentation for API and regulatory work is available on request, and salt form and purity can be set to your specification.
Yes. We manufacture ACTH (1-39), rat in-house and supply from research quantities up to scale-up batches. As a thirty-nine-residue peptide it is a demanding synthesis, and we can discuss the right approach for your scale. Contact us with your required purity and quantity for a quote.
ACTH (1-39), rat is the full-length adrenocorticotropic hormone (ACTH) carrying the rat amino-acid sequence. It is a potent melanocortin type-two receptor agonist and is used as a research peptide. We supply it as a raw material for research and pharmaceutical development.
ACTH (1-39), rat is a thirty-nine-residue peptide, SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF, representing the complete ACTH hormone as found in rat and mouse. The first twenty-four residues are shared across mammals, while the part after residue twenty-four differs from the human sequence. It is a native sequence with no chemical modifications, no D-amino acids, and no disulfide bonds. Its CAS number is 77465-10-2, its molecular formula is C210H315N57O57S, and its molecular weight is about 4582.
ACTH (1-39), rat binds and activates the melanocortin type-two receptor on the adrenal cortex, signalling the adrenal glands to produce and release corticosteroids, and it has additional melanocortin activity at related receptors. As the full-length hormone it contains both the active N-terminal core and the longer sequence associated with potent, sustained receptor activity.
ACTH (1-39), rat is the complete hormone, whereas shorter fragments capture only parts of it. ACTH (1-24) keeps the first twenty-four residues and the full corticosteroid-stimulating activity used in adrenal function testing, while ACTH (1-10) keeps only the melanocortin core and is used as a research and model peptide.
As a long thirty-nine-residue peptide, ACTH (1-39) benefits from established synthesis and purification methods. We supply it with a certificate of analysis, HPLC purity data, and mass-spectrometry identity confirmation, with further documentation available to support active pharmaceutical ingredient and regulatory work, and purity and counter-ion set to your specification.
We manufacture ACTH (1-39), rat by solid-phase synthesis and supply it from research quantities through to scale-up batches. For related capabilities, see drug peptides and custom peptide synthesis. Material is supplied for research and pharmaceutical manufacturing use only.
